ADDHURI MOVIE PICS

Showing photos of “Addhuri”. There are sequences, which are little slow in narration. Bleach bypass technique which is an optical technique is very rarely used for the entire movie in the world of cinema. Dhruva Sarja’s Bahaddur back on track? Attractive locations, some are used in Bangalore streets. You can change your city from here. We serve personalized stories based on the selected city OK.

Their argument soon enters into a situation where Arjun is forced to lie to stop Poorna from abandoning him and leave to Delhi. The film collects Rs 70 lakhs. Tarun rejoices in the many twists and turns that Arjun endures to win Poorna’a love. Arjun returns and pleads to Poorna to get back. Go to movie details. Two stop push, bleach bypass technique has been adopted for Adduri cave scenes. Over the past few years Kannada film industry is producing low quality films which are not worth of watching for the second time. This is the first time in India that an entire movie has been produced using this technique.

Photography is really astonishing, which is taken in simple, different but attractive locations. AddhuriAddhuri kannada filmarjundhruv sarjafilm-reviewharikrishnaradhika panditsandalwood. However, the trend has changed now.

Pageviews for each item are divided by the aggregate number of pageviews generated by the items displayed. Dhruva Sarja shoots a song sequence for Bahaddur in Ban The first half is breezy.

Both Arjun and Poorna agree to be together and visit places they had frequented during the time when their love blossomed. Keep track of everything you watch; tell your friends. Kannada Movies that made good debuts: Five aimless youths are offered money to assassinate a local gangster. Oscars Hosts Through The Years: Two young people, Venkatesh and Nandini, get embroiled in a murder case when the strict principal is killed after he humiliates Nandini.

Addhuri Movie Stills, Addhuri Movie Gallery, Addhuri Photo Gallery, Addhuri Photos

There is nothing great in the story or romance, but what make difference are the lively sequences, attractive acting, dialogue movis and an amazing narration. The Surgical Strike’ box office collection day Tarun is impressed with Arjun and promises any help he can offer for Arjun to reclaim his love and leaves. This article includes a list of referencesbut its sources remain unclear because it has insufficient inline citations.

  HOLLYWOOD THEATRE MATTYDALE MOVIE TIMES

Shooting for Bahaddur resumes. It is now revealed that Arjun was nicknamed ‘Achhu’ and Poorna was nicknamed ‘Rachhu’ and they referred to themselves using the addhugi names from the time they fell in love.

Tarun’s inclusion in the film was a well-kept secret, but the actor has really made an impact through his role. The technique was adopted from the movie “Dildaara”. While extracting good performances from the lead artists in the film, Arjun has managed to obtain impressive work from his technical team consisting of music director Hari Krishna, cameraman Surya Kiran, art director Mohan Kere, editor Deepu, choreographers Harsha and Imran, and action director Ravi Ardhuri as well.

Yash, Sheena Shahabadi, Prakash Raj. Action scenes are worth for appreciation. Arjun’s “Addhuri” comes as a breath of fresh air in the stagnant Kannada film industry.

Dhruv Sarja has proved his ability in this debut, handsome with a good physique grabs the attention of youth. Ticket availability is avdhuri one week. Arjun meets Poorna and instantly falls for her. I never expected such a huge opening for a addhurri featuring a newcomer and from a director who was just making his second film.

It has all the elements that can make it a big hit. Well-made film and I could see happiness in the faces of audience when they come out of the theatre. Full Cast and Crew.

SRK-Suhana in matching outfits at airport. He adshuri for college student Ananya after a series of chance meetings. There is a technical quality in the film.

Kannada Review: ‘Addhuri’ replete with emotions

Mumbai Mumbai search close. One day he sets out afdhuri convey the love on behalf of his friend to a girl, to his surprise adfhuri finds out that it She has her own confusions and does not want to commit her love for Arjun. The collections of theatres which did not report housefuls in interiors have shown tremendous improvements in the matinee and evening shows.

  DWTS SEASON 19 WEEK 9 TOMMY PETA AND SHARNA

Tarun rejoices in the many mkvie and turns that Arjun endures to win Poorna’a love. Street-smart and intelligent, he does not want to be the Good Samaritan like Bhagat Singh that his mother wants him to be. A light-hearted movie that revolves around Vikram Kumar alias Lucky Yash who is in love with a television anchor Gowri Ramya.

The seven days they spend together, and all the sequences of the entire story is surrounded in this with the narration of flashback of 1 Year love story. Raate set to go on floors on May 2. Most of the location spots are known to people, but definitely not in this angle. Arjun challenges Poorna that he can moive her back if she agrees to be with him for these last 6 days, in which he wants her to accompany her to all the places they had been as lovers before.

Addhuri Movie Photos

A man whose life seems straight out of a classic Kannada movie faces highs and lows in life and love. Arjun tries valiantly to patch adduhri with Poorna, who is vehemently denying his every apology and request to reconcile. By continuing to use this website, you agree to their use. Will Shahid Kapoor do the Hindi remake of Addhuri?